+Owner: Bonnie Green
Title: Home
Description: Not available
Keywords:Not available
Domain Ownership Lookup 
bonnie domains
Results of domain names owned by "bonnie" (Person or Organization)
Page 10 of 304 results
Owner: Bonnie Groessl
Title: sleep | Just another WordPress site
Description: Not available
Keywords:Not available
#0 (
0%) - bonniesproducts.com
0%) - bonniesproducts.comOwner: Bonnie Gunn
Title: Home
Description: Not available
Keywords:Not available
#8,838,141 (0%) - bndestin.com
0%) - bndestin.comOwner: Bonnie Hall
Title: Santa Rosa Beach Real Estate For Sale - Realtor Bonnie Hall
Description: Start searching for Santa Rosa Beach Real Estate For Sale with Realtor Bonnie Hall. Or list your property and get is posted on the MLS.
Keywords:Not available
#0 (0%) - africanamericanaffinityatwalker.org
0%) - africanamericanaffinityatwalker.orgOwner: Bonnie Hall
Title: AFRICAN AMERICAN AFFINITY GROUP | at the Walker School
Description: Not available
Keywords:Not available
Owner: bonnie halligan
Title: The Pied Piper Youth Theater
Description: A children's theatre located in Stormville, New York dedicated to nurturing young people's lives through the theatrical arts.
Keywords:Not available
Owner: Bonnie Halper Associates
Title: sendresume.com
Description: sendresume.com is a New Media/New Technology recruiting group that focus exclusively on this industry, working with some of the top companies in Interactive and New Media. From the long-established to the newly-established players in advertising, enterta
Keywords:recruiting, recruiters, employent, job, career, salary, resume, coding, coder, programming, programmer, web programming, web design, html, internet, intranet, interactive, database, Java, C++, PERL, CGI, UNIX, OOD, Novell,
... (View More)
#0 (0%) - greatertamparealestate.com
0%) - greatertamparealestate.comOwner: Bonnie Harbaugh
Title: Not available
Description: Not available
Keywords:Not available
Owner: Bonnie Harris
Title: Bonnie Harris Connective Parenting
Description: Bonnie Harris is dedicated to guiding parents in the discovery of why both they and their children behave and respond the way they do. Connective Parenting explores the heart of the parent-child relationship and guides parents in honoring the potential i
Keywords:Bonnie Harris, connective parenting, parenting books, when your kids push your buttons, confident parents remarkable kids, parenting, discipline, angry parents, connection, parenting workshops, parenting talks, coaching, counseling, mindful parenting, when kids dont listen, problem solving, consequences, childrens behavior, raising kids, trust, balance, empathy, communication, parent responsibility, conscious,
... (View More)
Owner: Bonnie Hart
Title: EcoVoice: Voice of the Earth | Environment Magazine
Description: Environment news, articles, events & products from Australia and overseas
